| Class b: All beta proteins [48724] (180 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries) |
| Domain d1l6oa1: 1l6o A:251-340 [84534] Other proteins in same PDB: d1l6oa2, d1l6ob2, d1l6oc2 complexed with a peptide from Daper 1, chains D, E and F |
PDB Entry: 1l6o (more details), 2.2 Å
SCOPe Domain Sequences for d1l6oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6oa1 b.36.1.1 (A:251-340) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvak
Timeline for d1l6oa1:
View in 3DDomains from other chains: (mouse over for more information) d1l6ob1, d1l6ob2, d1l6oc1, d1l6oc2 |