SCOP 1.69: Domain d1l6mc_: 1l6m C:

Lineage for d1l6mc_ (1l6m C:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (18 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (4 PDB entries)

8. Domain d1l6mc_: 1l6m C: [84533]

Details for d1l6mc_

PDB Entry: 1l6m, 2.4 Å

PDB Description: neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition

SCOP Domain Sequences for d1l6mc_:

Sequence, based on SEQRES records:

>d1l6mc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d1l6mc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtketselkenfirfskslglpenhivfpvpidqcid

Timeline for d1l6mc_:

• d1l6mc_ first appeared in SCOP 1.65
  
• d1l6mc_ appears in SCOP 1.67
  
• d1l6mc_ appears in SCOP 1.71
  
• d1l6mc_ appears in the current release, SCOPe 2.08