Lineage for d1l6mc_ (1l6m C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 564341Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 564342Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 564343Family b.60.1.1: Retinol binding protein-like [50815] (19 proteins)
    barrel, closed; n=8, S=12, meander
  6. 564439Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 564440Species Human (Homo sapiens) [TaxId:9606] [50836] (4 PDB entries)
  8. 564443Domain d1l6mc_: 1l6m C: [84533]
    complexed with dbh, dbs, fe, so4; mutant

Details for d1l6mc_

PDB Entry: 1l6m (more details), 2.4 Å

PDB Description: neutrophil gelatinase-associated lipocalin is a novel bacteriostatic agent that interferes with siderophore-mediated iron acquisition

SCOP Domain Sequences for d1l6mc_:

Sequence, based on SEQRES records: (download)

>d1l6mc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records): (download)

>d1l6mc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens)}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtketselkenfirfskslglpenhivfpvpidqcid

SCOP Domain Coordinates for d1l6mc_:

Click to download the PDB-style file with coordinates for d1l6mc_.
(The format of our PDB-style files is described here.)

Timeline for d1l6mc_: