SCOP 1.71: Domain d1l0ld2: 1l0l D:196-240

Lineage for d1l0ld2 (1l0l D:196-240)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (1 family)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (12 PDB entries)

8. Domain d1l0ld2: 1l0l D:196-240 [84489]
   Other proteins in same PDB: d1l0la1, d1l0la2, d1l0lb1, d1l0lb2, d1l0lc1, d1l0lc2, d1l0ld1, d1l0le1, d1l0le2, d1l0lf_, d1l0lg_, d1l0lh_, d1l0li_, d1l0lj_, d1l0lk_
   complexed with fes, fmx, hem

Details for d1l0ld2

PDB Entry: 1l0l, 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone

SCOP Domain Sequences for d1l0ld2:

Sequence; same for both SEQRES and ATOM records:

>d1l0ld2 f.23.11.1 (D:196-240) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp

Timeline for d1l0ld2:

• d1l0ld2 first appeared in SCOP 1.65
  
• d1l0ld2 appears in SCOP 1.69
  
• d1l0ld2 appears in SCOP 1.73
  
• d1l0ld2 appears in the current release, SCOPe 2.08