Details for d1l0ld2

PDB Entry: 1l0l (more details), 2.35 Å

PDB Description: structure of bovine mitochondrial cytochrome bc1 complex with a bound fungicide famoxadone
PDB Compounds: (D:) cytochrome c1, heme protein

SCOP Domain Sequences for d1l0ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0ld2 f.23.11.1 (D:196-240) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp

SCOP Domain Coordinates for d1l0ld2:

Click to download the PDB-style file with coordinates for d1l0ld2.
(The format of our PDB-style files is described here.)

Timeline for d1l0ld2: