SCOPe 2.06: Domain d1kh3b1: 1kh3 B:1-165

Lineage for d1kh3b1 (1kh3 B:1-165)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)

6. Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)

8. Domain d1kh3b1: 1kh3 B:1-165 [84394]
   Other proteins in same PDB: d1kh3a2, d1kh3b2, d1kh3c2, d1kh3d2
   complexed with anp, arg, mg, so4

Details for d1kh3b1

PDB Entry: 1kh3, 2.15 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitor

PDB Compounds: (B:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kh3b1:

Sequence; same for both SEQRES and ATOM records:

>d1kh3b1 c.26.2.1 (B:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

Timeline for d1kh3b1:

• d1kh3b1 first appeared in SCOP 1.65
  
• d1kh3b1 appears in SCOPe 2.05
  
• d1kh3b1 appears in SCOPe 2.07
  
• d1kh3b1 appears in the current release, SCOPe 2.08