Lineage for d1kh3b1 (1kh3 B:1-165)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2119958Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2119959Protein Argininosuccinate synthetase, N-terminal domain [69458] (3 species)
  7. 2119970Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)
  8. 2119984Domain d1kh3b1: 1kh3 B:1-165 [84394]
    Other proteins in same PDB: d1kh3a2, d1kh3b2, d1kh3c2, d1kh3d2
    complexed with anp, arg, mg, so4

Details for d1kh3b1

PDB Entry: 1kh3 (more details), 2.15 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with inhibitor
PDB Compounds: (B:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1kh3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kh3b1 c.26.2.1 (B:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

SCOPe Domain Coordinates for d1kh3b1:

Click to download the PDB-style file with coordinates for d1kh3b1.
(The format of our PDB-style files is described here.)

Timeline for d1kh3b1: