SCOP 1.69: Domain d1k9ub_: 1k9u B:

Lineage for d1k9ub_ (1k9u B:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.10: Polcalcin [89048] (3 proteins)
   calcium-binding pollen allergen; two EF-hands per subunit

6. Protein Polcalcin phl p 7 [89049] (1 species)

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [89050] (1 PDB entry)

8. Domain d1k9ub_: 1k9u B: [84349]
   EF-hand swapped homodimer

Details for d1k9ub_

PDB Entry: 1k9u, 1.75 Å

PDB Description: Crystal Structure of the Calcium-Binding Pollen Allergen Phl p 7 (Polcalcin) at 1.75 Angstroem

SCOP Domain Sequences for d1k9ub_:

Sequence; same for both SEQRES and ATOM records:

>d1k9ub_ a.39.1.10 (B:) Polcalcin phl p 7 {Timothy grass (Phleum pratense)}
ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
fcnanpglmkdvakvf

Timeline for d1k9ub_:

• d1k9ub_ first appeared in SCOP 1.65
  
• d1k9ub_ appears in SCOP 1.67
  
• d1k9ub_ appears in SCOP 1.71
  
• d1k9ub_ appears in the current release, SCOPe 2.08