Lineage for d1k9ub_ (1k9u B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 538145Family a.39.1.10: Polcalcin [89048] (3 proteins)
    calcium-binding pollen allergen; two EF-hands per subunit
  6. 538149Protein Polcalcin phl p 7 [89049] (1 species)
  7. 538150Species Timothy grass (Phleum pratense) [TaxId:15957] [89050] (1 PDB entry)
  8. 538152Domain d1k9ub_: 1k9u B: [84349]
    EF-hand swapped homodimer
    complexed with ca, so4

Details for d1k9ub_

PDB Entry: 1k9u (more details), 1.75 Å

PDB Description: Crystal Structure of the Calcium-Binding Pollen Allergen Phl p 7 (Polcalcin) at 1.75 Angstroem

SCOP Domain Sequences for d1k9ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ub_ a.39.1.10 (B:) Polcalcin phl p 7 {Timothy grass (Phleum pratense)}
ddmerifkrfdtngdgkislseltdalrtlgstsadevqrmmaeidtdgdgfidfnefis
fcnanpglmkdvakvf

SCOP Domain Coordinates for d1k9ub_:

Click to download the PDB-style file with coordinates for d1k9ub_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ub_: