Lineage for d1k1xa3 (1k1x A:1-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850572Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2850636Family c.6.2.2: 4-alpha-glucanotransferase, N-terminal domain [89554] (1 protein)
    family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family
    automatically mapped to Pfam PF03065
  6. 2850637Protein 4-alpha-glucanotransferase, N-terminal domain [89555] (1 species)
  7. 2850638Species Thermococcus litoralis [TaxId:2265] [89556] (3 PDB entries)
  8. 2850639Domain d1k1xa3: 1k1x A:1-310 [84281]
    Other proteins in same PDB: d1k1xa1, d1k1xa2, d1k1xb1, d1k1xb2
    complexed with ca, trs

Details for d1k1xa3

PDB Entry: 1k1x (more details), 2.4 Å

PDB Description: Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d1k1xa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k1xa3 c.6.2.2 (A:1-310) 4-alpha-glucanotransferase, N-terminal domain {Thermococcus litoralis [TaxId: 2265]}
merinfifgihnhqplgnfgwvfeeaynrsyrpfmeileefpemkvnvhfsgpllewiee
nkpdyldllrslikrgqleivvagfyepvlaaipkedrlvqiemlkdyarklgydakgvw
ltervwqpelvkslreagieyvvvddyhfmsaglskeelfwpyytedggevitvfpidek
lrylipfrpvkktieylesltsddpskvavfhddgekfgvwpgtyewvyekgwlreffda
itsnekinlmtyseylskftprglvylpiasyfemsewslpakqaklfvefveqlkeegk
fekyrvfvrg

SCOPe Domain Coordinates for d1k1xa3:

Click to download the PDB-style file with coordinates for d1k1xa3.
(The format of our PDB-style files is described here.)

Timeline for d1k1xa3: