Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.8: 4-alpha-glucanotransferase, C-terminal domain [89286] (1 protein) family 57 glycoside hydrolase; overall domain organization is similar to that of the alpha-mannosidase family automatically mapped to Pfam PF09095 |
Protein 4-alpha-glucanotransferase, C-terminal domain [89287] (1 species) |
Species Thermococcus litoralis [TaxId:2265] [89288] (3 PDB entries) |
Domain d1k1xa2: 1k1x A:385-659 [84280] Other proteins in same PDB: d1k1xa1, d1k1xa3, d1k1xb1, d1k1xb3 complexed with ca, trs |
PDB Entry: 1k1x (more details), 2.4 Å
SCOPe Domain Sequences for d1k1xa2:
Sequence, based on SEQRES records: (download)
>d1k1xa2 b.30.5.8 (A:385-659) 4-alpha-glucanotransferase, C-terminal domain {Thermococcus litoralis [TaxId: 2265]} kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh evpeatkpekeseegiasihelgkqipeeirrelaydwqlrailqdhfikpeetldnyrl vkyhelgdfvnqpyeyemiengvklwreggvyaeekiparvekkieltedgfiakyrvll ekpykalfgveinlavhsvmekpeefeakefevndpygigkvrieldkaakvwkfpiktl sqseagwdfiqqgvsytmlfpiekeleftvrfrel
>d1k1xa2 b.30.5.8 (A:385-659) 4-alpha-glucanotransferase, C-terminal domain {Thermococcus litoralis [TaxId: 2265]} kpenkildvdfdgraeimvendgfiatikphyggsifelsskrkavnyndvlprrwehyh eqipeeirrelaydwqlrailqdhfikpeetldnyrlvkyhelgdfvnqpyeyemiengv klwreggvyaeekiparvekkieltedgfiakyrvllekpykalfgveinlavhsvmekp eefeakefevndpygigkvrieldkaakvwkfpiktlsqseagwdfiqqgvsytmlfpie keleftvrfrel
Timeline for d1k1xa2: