Lineage for d1jzne_ (1jzn E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607347Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 2607348Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 2607353Domain d1jzne_: 1jzn E: [84266]
    complexed with ca, cl, na

Details for d1jzne_

PDB Entry: 1jzn (more details), 2.2 Å

PDB Description: crystal structure of a galactose-specific c-type lectin
PDB Compounds: (E:) Galactose-specific lectin

SCOPe Domain Sequences for d1jzne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzne_ d.169.1.1 (E:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox) [TaxId: 8730]}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf

SCOPe Domain Coordinates for d1jzne_:

Click to download the PDB-style file with coordinates for d1jzne_.
(The format of our PDB-style files is described here.)

Timeline for d1jzne_: