Lineage for d1jzne_ (1jzn E:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421376Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 421377Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 421382Domain d1jzne_: 1jzn E: [84266]
    complexed with ca, cl, gal, glc, na

Details for d1jzne_

PDB Entry: 1jzn (more details), 2.2 Å

PDB Description: crystal structure of a galactose-specific c-type lectin

SCOP Domain Sequences for d1jzne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jzne_ d.169.1.1 (E:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox)}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf

SCOP Domain Coordinates for d1jzne_:

Click to download the PDB-style file with coordinates for d1jzne_.
(The format of our PDB-style files is described here.)

Timeline for d1jzne_: