| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (22 proteins) |
| Protein Galactose-specific C-type lectin [90061] (1 species) |
| Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries) |
| Domain d1jzna_: 1jzn A: [84262] |
PDB Entry: 1jzn (more details), 2.2 Å
SCOP Domain Sequences for d1jzna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jzna_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox)}
nncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyh
kgqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwnd
qvceskdaflcqckf
Timeline for d1jzna_:
View in 3DDomains from other chains: (mouse over for more information) d1jznb_, d1jznc_, d1jznd_, d1jzne_ |