| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species) |
| Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries) Uniprot P01903 28-207 probably orthologous to the mouse I-E group |
| Domain d1jwua1: 1jwu A:82-182 [84248] Other proteins in same PDB: d1jwua2, d1jwub1, d1jwub2, d1jwud1, d1jwud2 mutant |
PDB Entry: 1jwu (more details), 2.3 Å
SCOP Domain Sequences for d1jwua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwua1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda
Timeline for d1jwua1:
View in 3DDomains from other chains: (mouse over for more information) d1jwub1, d1jwub2, d1jwud1, d1jwud2 |