SCOP 1.71: Domain d1jwsa1: 1jws A:82-182

Lineage for d1jwsa1 (1jws A:82-182)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1jwsa1: 1jws A:82-182 [84242]
   Other proteins in same PDB: d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2
   mutant

Details for d1jwsa1

PDB Entry: 1jws, 2.6 Å

PDB Description: crystal structure of the complex of the mhc class ii molecule hla-dr1 (ha peptide 306-318) with the superantigen sec3 variant 3b1

SCOP Domain Sequences for d1jwsa1:

Sequence; same for both SEQRES and ATOM records:

>d1jwsa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1jwsa1:

• d1jwsa1 first appeared in SCOP 1.65
  
• d1jwsa1 appears in SCOP 1.69
  
• d1jwsa1 appears in SCOP 1.73
  
• d1jwsa1 appears in the current release, SCOPe 2.08