Lineage for d1jwsa1 (1jws A:82-182)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021990Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2021998Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 2022021Domain d1jwsa1: 1jws A:82-182 [84242]
    Other proteins in same PDB: d1jwsa2, d1jwsb1, d1jwsb2, d1jwsd1, d1jwsd2

Details for d1jwsa1

PDB Entry: 1jws (more details), 2.6 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1 (HA peptide 306-318) with the Superantigen SEC3 Variant 3B1
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1jwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwsa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d1jwsa1:

Click to download the PDB-style file with coordinates for d1jwsa1.
(The format of our PDB-style files is described here.)

Timeline for d1jwsa1: