SCOP 1.69: Domain d1jwma1: 1jwm A:82-182

Lineage for d1jwma1 (1jwm A:82-182)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1jwma1: 1jwm A:82-182 [84236]
   Other proteins in same PDB: d1jwma2, d1jwmb1, d1jwmb2, d1jwmd1, d1jwmd2

Details for d1jwma1

PDB Entry: 1jwm, 2.7 Å

PDB Description: Crystal Structure of the Complex of the MHC Class II Molecule HLA-DR1(HA peptide 306-318) with the Superantigen SEC3

SCOP Domain Sequences for d1jwma1:

Sequence; same for both SEQRES and ATOM records:

>d1jwma1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

Timeline for d1jwma1:

• d1jwma1 first appeared in SCOP 1.65
  
• d1jwma1 appears in SCOP 1.67
  
• d1jwma1 appears in SCOP 1.71
  
• d1jwma1 appears in the current release, SCOPe 2.08