Lineage for d1jtsm_ (1jts M:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 353828Family a.25.1.1: Ferritin [47241] (7 proteins)
  6. 353960Protein Dodecameric ferritin homolog [47250] (9 species)
  7. 353988Species Escherichia coli, Dps [TaxId:562] [47251] (7 PDB entries)
    ferritin homolog that binds to and protects DNA
  8. 354037Domain d1jtsm_: 1jts M: [84218]

Details for d1jtsm_

PDB Entry: 1jts (more details), 2.6 Å

PDB Description: dna protection and binding by e. coli dps protein

SCOP Domain Sequences for d1jtsm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtsm_ a.25.1.1 (M:) Dodecameric ferritin homolog {Escherichia coli, Dps}
tnllytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrt
alichlatmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivand
vrkaigeakdddtadiltaasrdldkflwfiesnie

SCOP Domain Coordinates for d1jtsm_:

Click to download the PDB-style file with coordinates for d1jtsm_.
(The format of our PDB-style files is described here.)

Timeline for d1jtsm_: