Lineage for d1jbob_ (1jbo B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 350323Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 350389Protein Phycocyanin beta subunit [88940] (6 species)
  7. 350424Species Synechococcus elongatus [TaxId:32046] [88968] (1 PDB entry)
  8. 350425Domain d1jbob_: 1jbo B: [84151]
    Other proteins in same PDB: d1jboa_
    complexed with cyc, men

Details for d1jbob_

PDB Entry: 1jbo (more details), 1.45 Å

PDB Description: The 1.45A Three-Dimensional Structure of c-Phycocyanin from the Thermophylic Cyanobacterium Synechococcus elongatus

SCOP Domain Sequences for d1jbob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbob_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus elongatus}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

SCOP Domain Coordinates for d1jbob_:

Click to download the PDB-style file with coordinates for d1jbob_.
(The format of our PDB-style files is described here.)

Timeline for d1jbob_: