| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins) forms homo and heteroheptameric ring structures |
| Protein Archaeal homoheptameric Sm protein [63758] (6 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries) MTH649, smap1 |
| Domain d1jbme_: 1jbm E: [84147] structural genomics complexed with acy, edo |
PDB Entry: 1jbm (more details), 1.85 Å
SCOPe Domain Sequences for d1jbme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbme_ b.38.1.1 (E:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisrgk
Timeline for d1jbme_: