Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.10: TGS-like [81271] (2 families) possibly related to the ubiquitin-like and MoaD/ThiS superfamilies; some similarity to the alpha-L RNA-binding motif |
Family d.15.10.2: YchF GTP-binding protein, C-terminal domain [82583] (1 protein) |
Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species) N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain |
Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry) HI0393 |
Domain d1jalb2: 1jal B:279-363 [84141] Other proteins in same PDB: d1jala1, d1jalb1 structural genomics |
PDB Entry: 1jal (more details), 2.4 Å
SCOP Domain Sequences for d1jalb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jalb2 d.15.10.2 (B:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae} lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake agkwrlegkdyivqdgdvmhfrfnv
Timeline for d1jalb2: