Lineage for d1jalb2 (1jal B:279-363)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 326075Superfamily d.15.10: TGS-like [81271] (2 families) (S)
    possibly related to the ubiquitin-like and MoaD/ThiS suprfamilies; some similarity to the alpha-L RNA-binding motif
  5. 326080Family d.15.10.2: YchF GTP-binding protein, C-terminal domain [82583] (1 protein)
  6. 326081Protein YchF GTP-binding protein, C-terminal domain [82584] (2 species)
    N-terminal domain belongs to the Obg family of GTPases some members of which contain a C-terminal TGS domain
  7. 326084Species Haemophilus influenzae [TaxId:727] [89836] (1 PDB entry)
    HI0393
  8. 326086Domain d1jalb2: 1jal B:279-363 [84141]
    Other proteins in same PDB: d1jala1, d1jalb1
    structural genomics

Details for d1jalb2

PDB Entry: 1jal (more details), 2.4 Å

PDB Description: ychf protein (hi0393)

SCOP Domain Sequences for d1jalb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jalb2 d.15.10.2 (B:279-363) YchF GTP-binding protein, C-terminal domain {Haemophilus influenzae}
lqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengake
agkwrlegkdyivqdgdvmhfrfnv

SCOP Domain Coordinates for d1jalb2:

Click to download the PDB-style file with coordinates for d1jalb2.
(The format of our PDB-style files is described here.)

Timeline for d1jalb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jalb1