Lineage for d1j20b2 (1j20 B:171-395)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612334Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2612335Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2612336Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)
  6. 2612337Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2612348Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 2612350Domain d1j20b2: 1j20 B:171-395 [83993]
    Other proteins in same PDB: d1j20a1, d1j20b1, d1j20c1, d1j20d1
    complexed with amp, as1, so4

Details for d1j20b2

PDB Entry: 1j20 (more details), 2 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with product
PDB Compounds: (B:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1j20b2:

Sequence, based on SEQRES records: (download)

>d1j20b2 d.210.1.1 (B:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1j20b2 d.210.1.1 (B:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1j20b2:

Click to download the PDB-style file with coordinates for d1j20b2.
(The format of our PDB-style files is described here.)

Timeline for d1j20b2: