Lineage for d1j1ea_ (1j1e A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268646Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1268647Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1269002Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1269440Protein Troponin C [47503] (6 species)
  7. 1269475Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (19 PDB entries)
  8. 1269487Domain d1j1ea_: 1j1e A: [83969]
    Other proteins in same PDB: d1j1eb_, d1j1ec_, d1j1ee_, d1j1ef_
    complexed with ca

Details for d1j1ea_

PDB Entry: 1j1e (more details), 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form
PDB Compounds: (A:) troponin c

SCOPe Domain Sequences for d1j1ea_:

Sequence, based on SEQRES records: (download)

>d1j1ea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
lqatgetiteddieelmkdgdknndgridydeflefmkgve

Sequence, based on observed residues (ATOM records): (download)

>d1j1ea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddkseeelsdlfrmfdknadgyidleelkimlqa
tgetiteddieelmkdgdknndgridydeflefmkgve

SCOPe Domain Coordinates for d1j1ea_:

Click to download the PDB-style file with coordinates for d1j1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ea_: