SCOPe 2.03: Domain d1j1ef_: 1j1e F:

Lineage for d1j1ef_ (1j1e F:)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families)
   form heterodimeric coiled coil

5. Family h.1.25.2: Troponin I [90254] (1 protein)

6. Protein Troponin I [90255] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries)

8. Domain d1j1ef_: 1j1e F: [83974]
   Other proteins in same PDB: d1j1ea_, d1j1eb_, d1j1ed_, d1j1ee_
   complexed with ca

Details for d1j1ef_

PDB Entry: 1j1e, 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form

PDB Compounds: (F:) troponin I

SCOPe Domain Sequences for d1j1ef_:

Sequence, based on SEQRES records:

>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq
lharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadammqall
garakesldlrahlkqvkkedtekenrevgdw

Sequence, based on observed residues (ATOM records):

>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq
lharvdkvdeerydieakvtkniteiadltqkifdlrrisadammqallgarakesldlr
ahlkqvkkedtekenrevgdw

Timeline for d1j1ef_:

• d1j1ef_ first appeared in SCOP 1.65
  
• d1j1ef_ appears in SCOPe 2.02
  
• d1j1ef_ appears in SCOPe 2.04
  
• d1j1ef_ appears in the current release, SCOPe 2.08