Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.2: Troponin I [90254] (1 protein) |
Protein Troponin I [90255] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries) |
Domain d1j1ef_: 1j1e F: [83974] Other proteins in same PDB: d1j1ea_, d1j1eb_, d1j1ed_, d1j1ee_ complexed with ca |
PDB Entry: 1j1e (more details), 3.3 Å
SCOPe Domain Sequences for d1j1ef_:
Sequence, based on SEQRES records: (download)
>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]} kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq lharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadammqall garakesldlrahlkqvkkedtekenrevgdw
>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]} kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq lharvdkvdeerydieakvtkniteiadltqkifdlrrisadammqallgarakesldlr ahlkqvkkedtekenrevgdw
Timeline for d1j1ef_: