Lineage for d1j19a2 (1j19 A:199-317)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378352Protein Radixin [50779] (1 species)
  7. 378353Species Mouse (Mus musculus) [TaxId:10090] [50780] (3 PDB entries)
  8. 378354Domain d1j19a2: 1j19 A:199-317 [83959]
    Other proteins in same PDB: d1j19a1, d1j19a3

Details for d1j19a2

PDB Entry: 1j19 (more details), 2.4 Å

PDB Description: Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide

SCOP Domain Sequences for d1j19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j19a2 b.55.1.5 (A:199-317) Radixin {Mouse (Mus musculus)}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqarvdssgaa

SCOP Domain Coordinates for d1j19a2:

Click to download the PDB-style file with coordinates for d1j19a2.
(The format of our PDB-style files is described here.)

Timeline for d1j19a2: