Class b: All beta proteins [48724] (141 folds) |
Fold b.55: PH domain-like [50728] (1 superfamily) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (8 families) |
Family b.55.1.5: Third domain of FERM [50776] (6 proteins) |
Protein Radixin [50779] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50780] (3 PDB entries) |
Domain d1j19a2: 1j19 A:199-317 [83959] Other proteins in same PDB: d1j19a1, d1j19a3 |
PDB Entry: 1j19 (more details), 2.4 Å
SCOP Domain Sequences for d1j19a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j19a2 b.55.1.5 (A:199-317) Radixin {Mouse (Mus musculus)} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqarvdssgaa
Timeline for d1j19a2: