Lineage for d1j19a2 (1j19 A:199-310)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803573Protein Radixin [50779] (1 species)
  7. 2803574Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2803576Domain d1j19a2: 1j19 A:199-310 [83959]
    Other proteins in same PDB: d1j19a1, d1j19a3, d1j19a4

Details for d1j19a2

PDB Entry: 1j19 (more details), 2.4 Å

PDB Description: Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d1j19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j19a2 b.55.1.5 (A:199-310) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkpdtievqqmkaqar

SCOPe Domain Coordinates for d1j19a2:

Click to download the PDB-style file with coordinates for d1j19a2.
(The format of our PDB-style files is described here.)

Timeline for d1j19a2: