Lineage for d1j0na1 (1j0n A:26-386)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284239Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array
  4. 284360Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incoplete toroid
  5. 284366Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 284393Protein Xanthan lyase [89111] (1 species)
  7. 284394Species Bacillus sp. gl1 [TaxId:84635] [89112] (2 PDB entries)
  8. 284396Domain d1j0na1: 1j0n A:26-386 [83913]
    Other proteins in same PDB: d1j0na2, d1j0na3
    complexed with ca, ceg

Details for d1j0na1

PDB Entry: 1j0n (more details), 2.4 Å

PDB Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan

SCOP Domain Sequences for d1j0na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j0na1 a.102.3.2 (A:26-386) Xanthan lyase {Bacillus sp. gl1}
sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
nwwhwqlgipmslndtavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
a

SCOP Domain Coordinates for d1j0na1:

Click to download the PDB-style file with coordinates for d1j0na1.
(The format of our PDB-style files is described here.)

Timeline for d1j0na1: