PDB entry 1j0n

View 1j0n on RCSB PDB site
Description: crystal structure of bacillus sp. gl1 xanthan lyase that acts on side chains of xanthan
Deposited on 2002-11-19, released 2003-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-22, with a file datestamp of 2003-04-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.169
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j0nA (A:)
    sdefdalrikwatlltggpaldpadsdiaartdklaqdandywedmdlsssrtyiwyalr
    gngtsdnvnavyerlrtmalaattvgsslygnadlkedildaldwlyvnsynstrsrsay
    nwwhwqlgipmslndtavllyddisaarmatymdtidyftpsigltganrawqaivvgvr
    avivkdavklaaarnglsgtgifpyatggdgfyadgsfvqhttfaytggygssvlettan
    lmyllsgstwsvsdpnqsnvwqwiyeayrpllykgammdmvrgreisrsyaqdhavghgi
    vasivrlaqfapaphaaafkqiakrviqedtfssfygdvstdtirlakaivddpsiapaa
    apnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdl
    aqysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynl
    sarkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaq
    tltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnrpatpstavtrnye
    tmwidhgtnpsgasygyvllpnktsaqvgayaadpaieivvntsgvqsvkektlglvgan
    fwtdttqtadlitsnkkasvmtreiaderleasvsdptqanngtiaielarsaegysadp
    gitvtqlaptikftvnvngakgksfhasfqlg