| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
| Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
| Protein Cytochrome p450 152a1 (Bs-beta) [89116] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [89117] (1 PDB entry) |
| Domain d1izob_: 1izo B: [83852] complexed with hem, pam |
PDB Entry: 1izo (more details), 2.1 Å
SCOPe Domain Sequences for d1izob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1izob_ a.104.1.1 (B:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]}
phdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfq
rqnalpkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtr
wekadevvlfeeakeilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrr
arpraeewievmiedaragllkttsgtalhemafhtqedgsqldsrmaaielinvlrpiv
aisyflvfsalalhehpkykewlrsgnsreremfvqevrryypfgpflgalvkkdfvwnn
cefkkgtsvlldlygtnhdprlwdhpdefrperfaereenlfdmipqggghaekghrcpg
egitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrk
Timeline for d1izob_: