Lineage for d1iywa1 (1iyw A:797-862)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1980026Superfamily a.2.7: tRNA-binding arm [46589] (5 families) (S)
    formerly a class II aminoacyl-tRNA synthetase N-domain
  5. 1980043Family a.2.7.3: Valyl-tRNA synthetase (ValRS) C-terminal domain [81635] (1 protein)
    automatically mapped to Pfam PF10458
  6. 1980044Protein Valyl-tRNA synthetase (ValRS) C-terminal domain [81634] (1 species)
  7. 1980045Species Thermus thermophilus [TaxId:274] [81633] (3 PDB entries)
  8. 1980050Domain d1iywa1: 1iyw A:797-862 [83807]
    Other proteins in same PDB: d1iywa2, d1iywa3, d1iywa4, d1iywb2, d1iywb3, d1iywb4
    preliminary structure of ligand-free enzyme; CA-atoms only

Details for d1iywa1

PDB Entry: 1iyw (more details), 4 Å

PDB Description: preliminary structure of thermus thermophilus ligand-free valyl-trna synthetase
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1iywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iywa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]}
dveewrrrqekrlkellalaersqrklaspgfrekapkevveaeearlkenleqaerire
alsqig

SCOPe Domain Coordinates for d1iywa1:

Click to download the PDB-style file with coordinates for d1iywa1.
(The format of our PDB-style files is described here.)

Timeline for d1iywa1: