| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89061] (15 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
| Domain d1iyid1: 1iyi D:676-799 [83804] Other proteins in same PDB: d1iyia2, d1iyib2, d1iyic2, d1iyid2 complexed with ca, gsh |
PDB Entry: 1iyi (more details), 1.8 Å
SCOPe Domain Sequences for d1iyid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iyid1 a.45.1.1 (D:676-799) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl
Timeline for d1iyid1: