Lineage for d1iyha1 (1iyh A:76-199)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356299Protein Class sigma GST [81351] (4 species)
  7. 356303Species Human (Homo sapiens) [TaxId:9606] [89061] (2 PDB entries)
    synonym: hematopoietic prostaglandin D synthase
  8. 356304Domain d1iyha1: 1iyh A:76-199 [83790]
    Other proteins in same PDB: d1iyha2, d1iyhb2, d1iyhc2, d1iyhd2

Details for d1iyha1

PDB Entry: 1iyh (more details), 1.7 Å

PDB Description: Crystal structure of hematopoietic prostaglandin D synthase

SCOP Domain Sequences for d1iyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iyha1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens)}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOP Domain Coordinates for d1iyha1:

Click to download the PDB-style file with coordinates for d1iyha1.
(The format of our PDB-style files is described here.)

Timeline for d1iyha1: