SCOP 1.71: Domain d1ioma_: 1iom A:

Lineage for d1ioma_ (1iom A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (1 family)

5. Family a.103.1.1: Citrate synthase [48257] (1 protein)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain

6. Protein Citrate synthase [48258] (7 species)

7. Species Thermus thermophilus [TaxId:274] [89115] (2 PDB entries)

8. Domain d1ioma_: 1iom A: [83698]
   complexed with co3, gol, so4

Details for d1ioma_

PDB Entry: 1iom, 1.5 Å

PDB Description: crystal structure of citrate synthase from thermus thermophilus hb8

SCOP Domain Sequences for d1ioma_:

Sequence; same for both SEQRES and ATOM records:

>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus}
varglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqele
efsaalarrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgl
dliakfativaankrlkegkepippredlshaanflymangvepspeqarlmdaalilha
ehgfnastftaiaafstetdlysaitaavaslkgprhgganeavmrmiqeigtperarew
vreklakkerimgmghrvykafdpragvleklarlvaekhghskeyqilkiveeeagkvl
nprgiypnvdfysgvvysdlgfslefftpifavarisgwvghileyqeldnrllrpgaky
vgeldvpyvplear

Timeline for d1ioma_:

• d1ioma_ first appeared in SCOP 1.65
  
• d1ioma_ appears in SCOP 1.69
  
• d1ioma_ appears in SCOP 1.73
  
• d1ioma_ appears in the current release, SCOPe 2.08