Class a: All alpha proteins [46456] (290 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein Citrate synthase [48258] (7 species) |
Species Thermus thermophilus [TaxId:274] [89115] (2 PDB entries) |
Domain d1ioma_: 1iom A: [83698] complexed with co3, gol, so4 |
PDB Entry: 1iom (more details), 1.5 Å
SCOPe Domain Sequences for d1ioma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]} varglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqele efsaalarrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgl dliakfativaankrlkegkepippredlshaanflymangvepspeqarlmdaalilha ehgfnastftaiaafstetdlysaitaavaslkgprhgganeavmrmiqeigtperarew vreklakkerimgmghrvykafdpragvleklarlvaekhghskeyqilkiveeeagkvl nprgiypnvdfysgvvysdlgfslefftpifavarisgwvghileyqeldnrllrpgaky vgeldvpyvplear
Timeline for d1ioma_: