Lineage for d1ioma_ (1iom A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2723005Species Thermus thermophilus [TaxId:274] [89115] (2 PDB entries)
  8. 2723006Domain d1ioma_: 1iom A: [83698]
    complexed with co3, gol, so4

Details for d1ioma_

PDB Entry: 1iom (more details), 1.5 Å

PDB Description: crystal structure of citrate synthase from thermus thermophilus hb8
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1ioma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioma_ a.103.1.1 (A:) Citrate synthase {Thermus thermophilus [TaxId: 274]}
varglegvlftesrmcyidgqqgklyyygipiqelaekssfeettflllhgrlprrqele
efsaalarrralpahllesfkrypvsahpmsflrtavsefgmldptegdisrealyekgl
dliakfativaankrlkegkepippredlshaanflymangvepspeqarlmdaalilha
ehgfnastftaiaafstetdlysaitaavaslkgprhgganeavmrmiqeigtperarew
vreklakkerimgmghrvykafdpragvleklarlvaekhghskeyqilkiveeeagkvl
nprgiypnvdfysgvvysdlgfslefftpifavarisgwvghileyqeldnrllrpgaky
vgeldvpyvplear

SCOPe Domain Coordinates for d1ioma_:

Click to download the PDB-style file with coordinates for d1ioma_.
(The format of our PDB-style files is described here.)

Timeline for d1ioma_: