SCOP 1.71: Domain d1in0b2: 1in0 B:90-163

Lineage for d1in0b2 (1in0 B:90-163)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.49: YajQ-like [89963] (1 family)
   duplication: consists of two domains of this fold swapped with their N-terminal strands

5. Family d.58.49.1: YajQ-like [89964] (1 protein)

6. Protein Hypothetical protein HI1034 [89965] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89966] (1 PDB entry)

8. Domain d1in0b2: 1in0 B:90-163 [83697]
   structural genomics
   CASP5
   complexed with hg, mmc, na

Details for d1in0b2

PDB Entry: 1in0, 2.14 Å

PDB Description: yajq protein (hi1034)

SCOP Domain Sequences for d1in0b2:

Sequence; same for both SEQRES and ATOM records:

>d1in0b2 d.58.49.1 (B:90-163) Hypothetical protein HI1034 {Haemophilus influenzae}
klyskeiklkqgietemakkitklvkdskikvqtqiqgeqvrvtgksrddlqaviqlvks
aelgqpfqfnnfrd

Timeline for d1in0b2:

• d1in0b2 first appeared in SCOP 1.65
  
• d1in0b2 appears in SCOP 1.69
  
• d1in0b2 appears in SCOP 1.73
  
• d1in0b2 appears in the current release, SCOPe 2.08