Lineage for d1in0a1 (1in0 A:2-89)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 605212Superfamily d.58.49: YajQ-like [89963] (1 family) (S)
    duplication: consists of two domains of this fold swapped with their N-terminal strands
  5. 605213Family d.58.49.1: YajQ-like [89964] (1 protein)
  6. 605214Protein Hypothetical protein HI1034 [89965] (1 species)
  7. 605215Species Haemophilus influenzae [TaxId:727] [89966] (1 PDB entry)
  8. 605216Domain d1in0a1: 1in0 A:2-89 [83694]

Details for d1in0a1

PDB Entry: 1in0 (more details), 2.14 Å

PDB Description: yajq protein (hi1034)

SCOP Domain Sequences for d1in0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1in0a1 d.58.49.1 (A:2-89) Hypothetical protein HI1034 {Haemophilus influenzae}
psfdivseitlhevrnavenanrvlstrydfrgveavielneknetikittesdfqleql
ieiligscikrgiehssldipaesehhg

SCOP Domain Coordinates for d1in0a1:

Click to download the PDB-style file with coordinates for d1in0a1.
(The format of our PDB-style files is described here.)

Timeline for d1in0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in0a2