| Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
| Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.49: YajQ-like [89963] (1 family) ![]() duplication: consists of two domains of this fold swapped with their N-terminal strands |
| Family d.58.49.1: YajQ-like [89964] (1 protein) |
| Protein Hypothetical protein HI1034 [89965] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [89966] (1 PDB entry) |
| Domain d1in0a1: 1in0 A:2-89 [83694] |
PDB Entry: 1in0 (more details), 2.14 Å
SCOP Domain Sequences for d1in0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1in0a1 d.58.49.1 (A:2-89) Hypothetical protein HI1034 {Haemophilus influenzae}
psfdivseitlhevrnavenanrvlstrydfrgveavielneknetikittesdfqleql
ieiligscikrgiehssldipaesehhg
Timeline for d1in0a1: