Lineage for d1in0b1 (1in0 B:2-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955765Superfamily d.58.49: YajQ-like [89963] (1 family) (S)
    duplication: consists of two domains of this fold swapped with their N-terminal strands
  5. 2955766Family d.58.49.1: YajQ-like [89964] (1 protein)
  6. 2955767Protein Hypothetical protein HI1034 [89965] (1 species)
  7. 2955768Species Haemophilus influenzae [TaxId:727] [89966] (1 PDB entry)
  8. 2955771Domain d1in0b1: 1in0 B:2-89 [83696]
    structural genomics
    CASP5
    complexed with hg, mmc, na

Details for d1in0b1

PDB Entry: 1in0 (more details), 2.14 Å

PDB Description: yajq protein (hi1034)
PDB Compounds: (B:) yajq protein

SCOPe Domain Sequences for d1in0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1in0b1 d.58.49.1 (B:2-89) Hypothetical protein HI1034 {Haemophilus influenzae [TaxId: 727]}
psfdivseitlhevrnavenanrvlstrydfrgveavielneknetikittesdfqleql
ieiligscikrgiehssldipaesehhg

SCOPe Domain Coordinates for d1in0b1:

Click to download the PDB-style file with coordinates for d1in0b1.
(The format of our PDB-style files is described here.)

Timeline for d1in0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1in0b2