SCOPe 2.08: Domain d1in0a1: 1in0 A:2-89

Lineage for d1in0a1 (1in0 A:2-89)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.49: YajQ-like [89963] (1 family)
   duplication: consists of two domains of this fold swapped with their N-terminal strands

5. Family d.58.49.1: YajQ-like [89964] (1 protein)

6. Protein Hypothetical protein HI1034 [89965] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [89966] (1 PDB entry)

8. Domain d1in0a1: 1in0 A:2-89 [83694]
   structural genomics
   CASP5
   complexed with hg, mmc, na

Details for d1in0a1

PDB Entry: 1in0, 2.14 Å

PDB Description: yajq protein (hi1034)

PDB Compounds: (A:) yajq protein

SCOPe Domain Sequences for d1in0a1:

Sequence; same for both SEQRES and ATOM records:

>d1in0a1 d.58.49.1 (A:2-89) Hypothetical protein HI1034 {Haemophilus influenzae [TaxId: 727]}
psfdivseitlhevrnavenanrvlstrydfrgveavielneknetikittesdfqleql
ieiligscikrgiehssldipaesehhg

Timeline for d1in0a1:

• d1in0a1 first appeared in SCOP 1.65
  
• d1in0a1 appears in SCOPe 2.07