SCOP 1.65: Domain d1i7lb2: 1i7l B:215-421

Lineage for d1i7lb2 (1i7l B:215-421)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families)

5. Family d.142.1.3: Synapsin C-terminal domain [56078] (2 proteins)

6. Protein Synapsin II [90030] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [90031] (2 PDB entries)

8. Domain d1i7lb2: 1i7l B:215-421 [83680]
   Other proteins in same PDB: d1i7la1, d1i7lb1
   complexed with atp

Details for d1i7lb2

PDB Entry: 1i7l, 2.35 Å

PDB Description: crystal structure analysis of the complex of the c domain of synapsin ii from rat with atp

SCOP Domain Sequences for d1i7lb2:

Sequence; same for both SEQRES and ATOM records:

>d1i7lb2 d.142.1.3 (B:215-421) Synapsin II {Rat (Rattus norvegicus)}
nslesiynfcdkpwvfaqmvaifktlggekfplieqtyypnhremltlptfpvvvkigha
hsgmgkvkvenhydfqdiasvvaltqtyataepfidakydirvqkignnykaymrtsisg
nwktntgsamleqiamsdryklwvdacsemfggldicavkavhgkdgkdyifevmdcsmp
ligehqvedrqlitdlviskmnqllsr

Timeline for d1i7lb2:

• d1i7lb2 is new in SCOP 1.65
  
• d1i7lb2 appears in SCOP 1.67
  
• d1i7lb2 appears in the current release, SCOPe 2.08