SCOP 1.65: Domain d1i7lb1: 1i7l B:113-214

Lineage for d1i7lb1 (1i7l B:113-214)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (5 families)
   preceeds the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.5: Synapsin domain [52463] (2 proteins)

6. Protein Synapsin II [89635] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [89636] (2 PDB entries)

8. Domain d1i7lb1: 1i7l B:113-214 [83679]
   Other proteins in same PDB: d1i7la2, d1i7lb2
   complexed with atp

Details for d1i7lb1

PDB Entry: 1i7l, 2.35 Å

PDB Description: crystal structure analysis of the complex of the c domain of synapsin ii from rat with atp

SCOP Domain Sequences for d1i7lb1:

Sequence; same for both SEQRES and ATOM records:

>d1i7lb1 c.30.1.5 (B:113-214) Synapsin II {Rat (Rattus norvegicus)}
kakvllvvdephtdwakcfrgkkilgdydikveqaefselnlvahadgtyavdmqvlrng
tkvvrsfrpdfvlirqhafgmaenedfrhlvigmqyaglpsi

Timeline for d1i7lb1:

• d1i7lb1 is new in SCOP 1.65
  
• d1i7lb1 appears in SCOP 1.67
  
• d1i7lb1 appears in the current release, SCOPe 2.08