Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.5: Synapsin domain [52463] (2 proteins) |
Protein Synapsin II [89635] (1 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [89636] (2 PDB entries) |
Domain d1i7lb1: 1i7l B:113-214 [83679] Other proteins in same PDB: d1i7la2, d1i7lb2 complexed with atp |
PDB Entry: 1i7l (more details), 2.35 Å
SCOP Domain Sequences for d1i7lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7lb1 c.30.1.5 (B:113-214) Synapsin II {Rat (Rattus norvegicus)} kakvllvvdephtdwakcfrgkkilgdydikveqaefselnlvahadgtyavdmqvlrng tkvvrsfrpdfvlirqhafgmaenedfrhlvigmqyaglpsi
Timeline for d1i7lb1: