Lineage for d1i29a_ (1i29 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613596Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1613761Protein NifS-like protein/selenocysteine lyase [53412] (2 species)
  7. 1613762Species Escherichia coli [TaxId:562] [53414] (5 PDB entries)
    gene product CsdB
  8. 1613766Domain d1i29a_: 1i29 A: [83664]
    complexed with lpg, plp

Details for d1i29a_

PDB Entry: 1i29 (more details), 2.8 Å

PDB Description: crystal structure of csdb complexed with l-propargylglycine
PDB Compounds: (A:) csdb

SCOPe Domain Sequences for d1i29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i29a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]}
ifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtl
saqatekmenvrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqm
ehhanivpwqmlcarvgaelrviplnpdgtlqletlptlfdektrllaithvsnvlgten
plaemitlahqhgakvlvdgaqavmhhpvdvqaldcdfyvfsghklygptgigilyvkea
llqemppwegggsmiatvslsegttwtkapwrfeagtpntggiiglgaaleyvsalglnn
iaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhaydvgsfldnygiavrtg
hhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg

SCOPe Domain Coordinates for d1i29a_:

Click to download the PDB-style file with coordinates for d1i29a_.
(The format of our PDB-style files is described here.)

Timeline for d1i29a_: