Lineage for d1hwue_ (1hwu E:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651264Protein PII (product of glnB) [54915] (7 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 1651294Species Herbaspirillum seropedicae [TaxId:964] [89930] (1 PDB entry)
  8. 1651299Domain d1hwue_: 1hwu E: [83637]

Details for d1hwue_

PDB Entry: 1hwu (more details), 2.1 Å

PDB Description: structure of pii protein from herbaspirillum seropedicae
PDB Compounds: (E:) pii protein

SCOPe Domain Sequences for d1hwue_:

Sequence, based on SEQRES records: (download)

>d1hwue_ d.58.5.1 (E:) PII (product of glnB) {Herbaspirillum seropedicae [TaxId: 964]}
mkqvtaiikpfkldevreslaevgvtgltvtevkgfgrqkghtelyrgaeyvvdflpkvk
ievvvddkvveqavdaiikaartgkigdgkifvqeveqvirirtg

Sequence, based on observed residues (ATOM records): (download)

>d1hwue_ d.58.5.1 (E:) PII (product of glnB) {Herbaspirillum seropedicae [TaxId: 964]}
mkqvtaiikpfkldevreslaevgvtgltvtevkgpkvkievvvddkvveqavdaiikaa
rtgkigdgkifvqeveqvirirtg

SCOPe Domain Coordinates for d1hwue_:

Click to download the PDB-style file with coordinates for d1hwue_.
(The format of our PDB-style files is described here.)

Timeline for d1hwue_: