Lineage for d1hwud_ (1hwu D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950564Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 2950570Protein PII (product of glnB) [54915] (8 species)
    trimer with orthogonal packing of beta-sheets around the threefold axis
  7. 2950602Species Herbaspirillum seropedicae [TaxId:964] [89930] (1 PDB entry)
  8. 2950606Domain d1hwud_: 1hwu D: [83636]

Details for d1hwud_

PDB Entry: 1hwu (more details), 2.1 Å

PDB Description: structure of pii protein from herbaspirillum seropedicae
PDB Compounds: (D:) pii protein

SCOPe Domain Sequences for d1hwud_:

Sequence, based on SEQRES records: (download)

>d1hwud_ d.58.5.1 (D:) PII (product of glnB) {Herbaspirillum seropedicae [TaxId: 964]}
mkqvtaiikpfkldevreslaevgvtgltvtevkgfgrqkghtelyrgaeyvvdflpkvk
ievvvddkvveqavdaiikaartgkigdgkifvqeveqvirirtgetgpdav

Sequence, based on observed residues (ATOM records): (download)

>d1hwud_ d.58.5.1 (D:) PII (product of glnB) {Herbaspirillum seropedicae [TaxId: 964]}
mkqvtaiikpfkldevreslaevgvtgltvtevkgfeyvvdflpkvkievvvddkvveqa
vdaiikaartgkigdgkifvqeveqvirirtgetgpdav

SCOPe Domain Coordinates for d1hwud_:

Click to download the PDB-style file with coordinates for d1hwud_.
(The format of our PDB-style files is described here.)

Timeline for d1hwud_: