Lineage for d1hq4a2 (1hq4 A:108-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360423Species Mouse (Mus musculus) [TaxId:10090] [88567] (368 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2360688Domain d1hq4a2: 1hq4 A:108-214 [83622]
    Other proteins in same PDB: d1hq4a1, d1hq4b1, d1hq4b2, d1hq4c1, d1hq4d1, d1hq4d2
    part of catalytic Fab HA-19A4 with a polyene cyclase activity
    complexed with cd

Details for d1hq4a2

PDB Entry: 1hq4 (more details), 2.7 Å

PDB Description: structure of native catalytic antibody ha5-19a4
PDB Compounds: (A:) antibody ha5-19a4 fab light chain

SCOPe Domain Sequences for d1hq4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hq4a2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radvaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d1hq4a2:

Click to download the PDB-style file with coordinates for d1hq4a2.
(The format of our PDB-style files is described here.)

Timeline for d1hq4a2: