SCOPe 2.07: Domain d1hjvc2: 1hjv C:261-328

Lineage for d1hjvc2 (1hjv C:261-328)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
Protein Chitinase-3 like protein 1 (GP-39, YKL-40) [89884] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [89885] (7 PDB entries)
Domain d1hjvc2: 1hjv C:261-328 [83505]
Other proteins in same PDB: d1hjva1, d1hjvb1, d1hjvc1, d1hjvd1
complexed with nag, so4

Details for d1hjvc2

PDB Entry: 1hjv (more details), 2.75 Å

PDB Description: crystal structure of hcgp-39 in complex with chitin tetramer

PDB Compounds: (C:) chitinase-3 like protein 1

SCOPe Domain Sequences for d1hjvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjvc2 d.26.3.1 (C:261-328) Chitinase-3 like protein 1 (GP-39, YKL-40) {Human (Homo sapiens) [TaxId: 9606]}
fgrsftlassetgvgapisgpgipgrftkeagtlayyeicdflrgatvhrilgqqvpyat
kgnqwvgy

SCOPe Domain Coordinates for d1hjvc2:

Click to download the PDB-style file with coordinates for d1hjvc2.
(The format of our PDB-style files is described here.)

Timeline for d1hjvc2: