Lineage for d1hjua_ (1hju A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145755Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1145783Protein Beta-1,4-galactanase [89469] (4 species)
  7. 1145797Species Thielavia heterothallica, aka Myceliophthora thermophila [TaxId:78579] [89471] (2 PDB entries)
    Myceliophthora thermophila is the anamorph name whilst Thielavia heterothallica is the teleomorph name
  8. 1145798Domain d1hjua_: 1hju A: [83496]
    complexed with nag, peg, so4, trs

Details for d1hjua_

PDB Entry: 1hju (more details), 2.15 Å

PDB Description: structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and ph optimum.
PDB Compounds: (A:) beta-1,4-galactanase

SCOPe Domain Sequences for d1hjua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjua_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]}
altyrgvdwssvvveeragvsykntngnaqplenilaangvntvrqrvwvnpadgnynld
yniaiakrakaaglgvyidfhysdtwadpahqtmpagwpsdidnlswklynytldaankl
qnagiqptivsigneiragllwptgrtenwaniarllhsaawgikdsslspkpkimihld
ngwdwgtqnwwytnvlkqgtlelsdfdmmgvsfypfysssatlsalkssldnmaktwnke
iavvetnwpiscpnprysfpsdvknipfspegqttfitnvanivssvsrgvglfywepaw
ihnanlgsscadntmfsqsgqalsslsvfqri

SCOPe Domain Coordinates for d1hjua_:

Click to download the PDB-style file with coordinates for d1hjua_.
(The format of our PDB-style files is described here.)

Timeline for d1hjua_: