SCOPe 2.08: Domain d1h1oa2: 1h1o A:94-183

Lineage for d1h1oa2 (1h1o A:94-183)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Cytochrome c4 [46681] (2 species)

7. Species Thiobacillus ferrooxidans [TaxId:920] [88972] (1 PDB entry)

8. Domain d1h1oa2: 1h1o A:94-183 [83455]
   complexed with gol, hem, so4, zn

Details for d1h1oa2

PDB Entry: 1h1o, 2.13 Å

PDB Description: acidithiobacillus ferrooxidans cytochrome c4 structure supports a complex-induced tuning of electron transfer

PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d1h1oa2:

Sequence; same for both SEQRES and ATOM records:

>d1h1oa2 a.3.1.4 (A:94-183) Cytochrome c4 {Thiobacillus ferrooxidans [TaxId: 920]}
gikhagakegkaifnqgvtneqipacmechgsdgqgagpfprlagqrygyiiqqltyfhn
gtrvntlmnqiaknitvaqmkdvaaylssl

Timeline for d1h1oa2:

• d1h1oa2 first appeared in SCOP 1.65
  
• d1h1oa2 appears in SCOPe 2.07