![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Angiogenin [54094] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries) |
![]() | Domain d1h0dc_: 1h0d C: [83429] Other proteins in same PDB: d1h0da1, d1h0da2, d1h0db1, d1h0db2 complexed with gol, so4 |
PDB Entry: 1h0d (more details), 2 Å
SCOPe Domain Sequences for d1h0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h0dc_ d.5.1.1 (C:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]} ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif rrp
Timeline for d1h0dc_:
![]() Domains from other chains: (mouse over for more information) d1h0da1, d1h0da2, d1h0db1, d1h0db2 |